Web stats for Arujogishop - arujogishop.com

2.20 Rating by ClearWebStats
arujogishop.com is 4 years 11 months 2 weeks old. This website has a #18,105,885 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, arujogishop.com is SAFE to browse.
Get Custom Widget

Traffic Report of Arujogishop

Daily Unique Visitors: 27
Daily Pageviews: 54

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 18,105,885
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View arujogishop.com site advisor rating Not Applicable

Where is arujogishop.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with arujogishop.com

Hosted Country:

arujogishop.com hosted country US arujogishop.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View arujogishop.com HTML resources

Homepage Links Analysis

View arujogishop.com homepage link analysis
Page Title of Arujogishop
Bootstrap E-Commerce Template- DIGI Shop mini

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 8 H4 Headings: 15
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 23
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

arujogishop.com favicon - jenniferchemsales.com

View arujogishop.com Pagerank   arujogishop.com alexa rank Not Applicable   arujogishop.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

arujogishop.com favicon - shrivishwakarmasafetytraininginstitute.com

View arujogishop.com Pagerank   arujogishop.com alexa rank Not Applicable   arujogishop.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

arujogishop.com favicon - theshineenglishacademy.com

View arujogishop.com Pagerank   arujogishop.com alexa rank Not Applicable   arujogishop.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

arujogishop.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View arujogishop.com Pagerank   arujogishop.com alexa rank Not Applicable   arujogishop.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

arujogishop.com favicon - 247bestpillpharma.com

View arujogishop.com Pagerank   arujogishop.com alexa rank Not Applicable   arujogishop.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 11 May 2019 22:29:12 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
Upgrade: h2,h2c
Connection: Upgrade
Last-Modified: Sun, 27 Apr 2014 22:14:42 GMT
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 6179
Content-Type: text/html

Domain Information for arujogishop.com

Domain Registrar: BigRock Solutions Ltd arujogishop.com registrar info
Registration Date: 2019-05-07 4 years 11 months 2 weeks ago
Last Modified: 2019-05-10 4 years 11 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net arujogishop.com name server information 162.241.148.33 arujogishop.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net arujogishop.com name server information 162.241.148.33 arujogishop.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
arujogishop.com A 14399 IP:162.241.148.33
arujogishop.com NS 21599 Target:ns2.bh-ht-17.webhostbox.net
arujogishop.com NS 21599 Target:ns1.bh-ht-17.webhostbox.net
arujogishop.com SOA 21599 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:cpanel.webhostbox.net
Serial:2019051005
Refresh:86400
Retry:7200
Expire:3600000
arujogishop.com MX 14399 Target:arujogishop.com

Similarly Ranked Websites to Arujogishop

Serial Cart | AntiVirus, Internet Security Application Serial and License Shop

arujogishop.com favicon - serialcart.com

AntiVirus, Internet Security Application Serial and License Shop

View arujogishop.com Pagerank   Alexa rank for arujogishop.com 18,105,898   website value of arujogishop.com $ 8.95

Auto Insurance - Cheap Auto Insurance Quotes And Rates

arujogishop.com favicon - autoinsurancedeal.net

Auto insurance. Cheap auto insurance quotes and rates online. Get your FREE QUOTE by entering your zip code only. You could save possibly up 50% off today!

View arujogishop.com Pagerank   Alexa rank for arujogishop.com 18,105,943   website value of arujogishop.com $ 8.95

Orange County Hypnosis - Successful Hypnotherapy Programs by Benjamin Moss

arujogishop.com favicon - benmosshypnosis.com

Orange County Hypnosis offers proven successful hypnotherapy programs, anxiety release, fears-phobias, test anxiety, weight control, smoking cessation. Serving Newport Beach, Irvine, Laguna, and all of Orange County, OC.

View arujogishop.com Pagerank   Alexa rank for arujogishop.com 18,105,943   website value of arujogishop.com $ 8.95

HugeDomains.com - 42sPikes.com is for sale (42s Pikes)

arujogishop.com favicon - 42spikes.com

View arujogishop.com Pagerank   Alexa rank for arujogishop.com 18,105,982   website value of arujogishop.com $ 8.95

Vitisoft - Multysoft - Vitiwin : Logiciels et solutions informatiques professionnels

arujogishop.com favicon - vitisoft.fr

Créateurs de logiciels professionnels adaptés aux besoins de nos clients et experts en logiciel viticulture. Vitisoft : logiciel viticole de gestion commerciale. Vitiwin : logiciel de traçabilité vin et gestion de chai.

View arujogishop.com Pagerank   Alexa rank for arujogishop.com 18,106,036   website value of arujogishop.com $ 8.95

Full WHOIS Lookup for arujogishop.com

Domain Name: ARUJOGISHOP.COM
Registry Domain ID: 2388294058_DOMAIN_COM-VRSN
Registrar WHOIS Server: Whois.bigrock.com
Registrar URL: http://www.bigrock.com
Updated Date: 2019-05-10T04:23:12Z
Creation Date: 2019-05-07T10:49:36Z
Registry Expiry Date: 2020-05-07T10:49:36Z
Registrar: BigRock Solutions Ltd
Registrar IANA ID: 1495
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-11T22:27:05Z
Top Websites • Trending Websites • Subdomains Websites • Advertise • Link Us • FAQ • Remove • CuteStat • Privacy Policy • Contact
Copyright © 2024 ClearWebStats.com, All Rights Reserved.
Any other Brand Information used from us are the properties of their respective owners.